PTM Viewer PTM Viewer

AT5G61810.1

Arabidopsis thaliana [ath]

Mitochondrial substrate carrier family protein

No PTMs currently found

PLAZA: AT5G61810
Gene Family: HOM05D000177
Other Names: ATP/phosphate carrier 1; APC1

Link out to other resources with this protein ID : TAIR   |   PeptideAtlas   |   ARAPORT   |   PhosPhAt

PTMs

There are no stored PTMs for this protein

Sequence

Length: 478

MEAEKSKQNPGKKPVEATMEHVLVALRETKEKREIRIQKLFEFFDNSKLGFLDDTQIEKGLSSLSIPPKYRYASDFLKVCDSNRDGRVDYQEFRRYMDAKELELYKIFQAIDIEHNGDICPAELWEALDKAGIKIKDEELASFMEHVDKDNNGIITFEEWRDFLLLNPHEATIENIYHHWERVCLIDIGEQAVIPDGISAHAQRSKLLLAGGIAGAVSRTATAPLDRLKVALQVQRTNLGVVPTIKKIWREDKLLGFFRGNGLNVAKVAPESAIKFAAYEMLKPIIGGADGDIGTSGRLLAGGLAGAVAQTAIYPMDLVKTRLQTFVSEVGTPKLWKLTKDIWIQEGPRAFYRGLCPSLIGIIPYAGIDLAAYETLKDLSRAHFLHDTAEPGPLIQLGCGMTSGALGASCVYPLQVIRTRMQADSSKTSMGQEFLKTLRGEGLKGFYRGIFPNFFKVIPSASISYLVYEAMKKNLALD

Domains & Sites

Clear highlighted range 
Interpro Domains
Show IPR ID From To
IPR002048 36 64
68 170
Sites
Show Type Position
Active Site 81
Active Site 83
Active Site 85
Active Site 87
Active Site 92
Active Site 148
Active Site 150
Active Site 152
Active Site 159

BLAST


Perform a BLAST search for this sequence, or a part of this sequence (minimum 50 characters)
A downloadable tutorial can be found here